PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G49190.1
Common NameARR19, RR19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 608aa    MW: 69248.9 Da    PI: 4.7863
Description response regulator 19
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G49190.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like55.21.6e-17420473155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+ Wt+eLH++F+ea+e + G++  +  + l+ m ++g+t+++v+SHLQk+R+
  AT1G49190.1 420 KPRMTWTEELHQKFLEAIEII-GANPKVLVECLQEMRIEGITRSNVASHLQKHRI 473
                  79*******************.6665566678899*******************7 PP

2Response_reg60.87.2e-21361421107
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vd + + + +++q++++  y +v   +d+e+al+ l  +++++++++ D  mpg+dGl++lk+i+++  +lp++++++ ++ e + +a  +Ga 
   AT1G49190.1  36 VLVVDTNFTTLLNMKQIMKQYAY-QVSIETDAEKALAFLtsCKHEINIVIWDFHMPGIDGLQALKSITSKL-DLPVVIMSDDNQTESVMKATFYGAC 130
                   89*********************.***999*******99778888**********************8866.9************************ PP

                   EEEESS--HHHH CS
  Response_reg  96 dflsKpfdpeel 107
                   d+++Kp+++e +
   AT1G49190.1 131 DYVVKPVKEEVM 142
                   ******988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.2E-2633158IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.4E-2734161No hitNo description
SMARTSM004487.4E-1634145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011035.0635150IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.6E-1836143IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.60E-1737149No hitNo description
Gene3DG3DSA:1.10.10.601.7E-17418477IPR009057Homeodomain-like
SuperFamilySSF466896.45E-15418476IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-16420473IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000282anatomytrichome
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MLVGKISGYE DNTRSLERET SEITSLLSQF PGNTNVLVVD TNFTTLLNMK QIMKQYAYQV  60
SIETDAEKAL AFLTSCKHEI NIVIWDFHMP GIDGLQALKS ITSKLDLPVV IMSDDNQTES  120
VMKATFYGAC DYVVKPVKEE VMANIWQHIV RKRLIFKPDV APPVQSDPAR SDRLDQVKAD  180
FKIVEDEPII NETPLITWTE EIQPVQSDLV QANKFDQVNG YSPIMNQDNM FNKAPPKPRM  240
TWTEVIQPVQ SNLVQTKEFG QLNDYSQIMN QDSMYNKAAT KPQLTWTEEI QPVQSGLVQA  300
NEFSKVNGYS QSMNQDSMFN KSATNPRLTW NELLQPVQSD LVQSNEFSQF SDYSQIMNED  360
NMFNKAAKKP RMTWSEVFQP VQSHLVPTDG LDRDHFDSIT INGGNGIQNM EKKQGKKPRK  420
PRMTWTEELH QKFLEAIEII GANPKVLVEC LQEMRIEGIT RSNVASHLQK HRINLEENQI  480
PQQTQGNGWA TAYGTLAPSL QGSDNVNTTI PSYLMNGPAT LNQIQQNQYQ NGFLTMNNNQ  540
IITNPPPPLP YLDHHHQQQH QSSPQFNYLM NNEELLQASG LSATDLELTY PSLPYDPQEY  600
LINGYNYN
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341831750.0
Genevisible257492_at0.0
Expression AtlasAT1G49190-
AtGenExpressAT1G49190-
ATTED-IIAT1G49190-
Functional Description ? help Back to Top
Source Description
TAIRmember of Response Regulator: B- Type
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G49190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G49190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0160410.0AC016041.5 Genomic sequence for Arabidopsis thaliana BAC F27J15 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175345.10.0putative two-component response regulator ARR19
SwissprotQ9M9B91e-158ARR19_ARATH; Putative two-component response regulator ARR19
TrEMBLD7KE141e-178D7KE14_ARALL; Putative uncharacterized protein
STRINGAT1G49190.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  3. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  4. Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
    In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(2): p. 122-31
    [PMID:12610214]
  5. Heyl A,Schm
    Cytokinin signal perception and transduction.
    Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8
    [PMID:12972049]
  6. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  7. Cluis CP,Mouchel CF,Hardtke CS
    The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways.
    Plant J., 2004. 38(2): p. 332-47
    [PMID:15078335]
  8. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  9. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  10. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  11. Gifford ML,Dean A,Gutierrez RA,Coruzzi GM,Birnbaum KD
    Cell-specific nitrogen responses mediate developmental plasticity.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(2): p. 803-8
    [PMID:18180456]
  12. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]